Active Recombinant Human IL1RN Protein
| Cat.No. : | IL1RN-183I |
| Product Overview : | Recombinant Human IL1RN Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Description : | IL-1 Receptor Antagonist, also known as IL-1RA, ICIL-1RA, IRAP and IL-1RN, is a member of the interleukin 1 cytokine family. It is expressed by monocytes, neutrophils, macrophages, epithelial cells and fibroblasts. IL-1RA inhibits the activity of both IL-1alpha and IL-1beta, and modulates a variety of IL-1 related immune and inflammatory responses. It inhibits the activity of IL-1 by binding to the receptor IL-1R1 and preventing its association with the coreceptor IL-1RAP for signaling. Clinical studies are being conducted to investigate the use of IL-1RA in the treatment of sepsis, rheumatoid arthritis and chronic myelogenous leukemia. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 0.1 μg/mL, measured in a neutralization assay using D10S cells in the presence of 50pg/mL Human IL-1a. |
| Molecular Mass : | 18-23 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : | Lyophilized recombinant human IL-1 Receptor Antagonist remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human IL-1 Receptor Antagonist should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens ] |
| Official Symbol | IL1RN |
| Synonyms | IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; |
| Gene ID | 3557 |
| mRNA Refseq | NM_000577 |
| Protein Refseq | NP_000568 |
| MIM | 147679 |
| UniProt ID | P18510 |
| ◆ Recombinant Proteins | ||
| IL1RN-945E | Active Recombinant Equine IL1RN | +Inquiry |
| Il1rn-231M | Recombinant Mouse Interleukin-1 Receptor Antagonist | +Inquiry |
| IL1RN-254R | Recombinant Rabbit IL1RN Protein, His-tagged | +Inquiry |
| IL1RN-094C | Recombinant Cynomolgus IL1RN protein, His-tagged | +Inquiry |
| IL1RN-0278C | Recombinant Cynomolgus IL1RN protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
| IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
