Active Recombinant Mouse Il10 Protein (161 aa)

Cat.No. : Il10-029I
Product Overview : Recombinant Mouse Il10 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 161
Description : IL-10 is an immunosuppressive cytokine produced by a variety of mammalian cell types including macrophages, monocytes, T cells, B cells and keratinocytes. IL-10 inhibits the expression of proinflammatory cytokines such as IL-1 and TNFα. Like IL-4, IL-10 enhances humoral immune responses and attenuates cell-mediated immune reactions. Human IL-10 active on murine cells, but murine IL-10 is inactive on human cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells was found to be < 2 ng/mL, corresponding to a specific activity of > 5 × 10^5 units/mg.
Molecular Mass : Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 161 amino acids
AA Sequence : MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS
Endotoxin : Less than 1 EU/mg of rMuIL-10 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il10 interleukin 10 [ Mus musculus ]
Official Symbol Il10
Synonyms IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10;
Gene ID 16153
mRNA Refseq NM_010548
Protein Refseq NP_034678
UniProt ID P18893

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il10 Products

Required fields are marked with *

My Review for All Il10 Products

Required fields are marked with *

0
cart-icon