Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 1(Casp1) Protein, His-Tagged
Cat.No. : | RFL8659AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Casparian strip membrane protein 1(CASP1) Protein (Q9SIH4) (1-206aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-206) |
Form : | Lyophilized powder |
AA Sequence : | MAKESTTIDVGEPSTVTKSSSHVVKDAKKKGFVAVASRGGAKRGLAIFDFLLRLAAIAVT IGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVASYLVLSLPFSIVSIVR PHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNWLPICQQFGDFCQNVST AVVADSIAILFFIVLIIISAIALKRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CASP1 |
Synonyms | CASP1; At2g36100; F9C22.3; Casparian strip membrane protein 1; AtCASP1 |
UniProt ID | Q9SIH4 |
◆ Recombinant Proteins | ||
CASP1-10729H | Recombinant Human CASP1, GST-tagged | +Inquiry |
CASP1-1588HFL | Recombinant Full Length Human CASP1 Protein, N-His-tagged | +Inquiry |
CASP1-1266H | Recombinant Human CASP1 Protein (N120-D297, A317-H404), His tagged | +Inquiry |
CASP1-1639H | Recombinant Human Caspase 1, Apoptosis-Related Cysteine Peptidase (interleukin 1, beta, convertase), His-tagged | +Inquiry |
CASP1-1213H | Recombinant Human CASP1 Protein (Asn120-Asp297), N-His tagged | +Inquiry |
◆ Native Proteins | ||
CASP1-596H | Active Recombinant Human CASP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *