Name: Recombinant Human DUSP3, His-tagged
SKU: DUSP3-26911TH

Species :	Human
Source :	E.coli
Tag :	His
Protein Length :	205 amino acids
Description :	The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1.
Conjugation :	HIS
Molecular Weight :	23.000kDa inclusive of tags
Form :	Liquid
Purity :	>95% by SDS-PAGE
Storage buffer :	pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.88% Sodium chloride
Storage :	Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids :	MGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Sequence Similarities :	Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain.

Gene Name	DUSP3 dual specificity phosphatase 3 [ Homo sapiens ]
Official Symbol	DUSP3
Synonyms	DUSP3; dual specificity phosphatase 3; vaccinia virus phosphatase VH1 related , VHR; dual specificity protein phosphatase 3;
Gene ID	1845
mRNA Refseq	NM_004090
Protein Refseq	NP_004081
MIM	600183
Uniprot ID	P51452
Chromosome Location	17q21
Pathway	Activated TLR4 signalling, organism-specific biosystem; ERK/MAPK targets, organism-specific biosystem; ERKs are inactivated, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem;
Function	MAP kinase phosphatase activity; hydrolase activity; phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity;

◆ Recombinant Proteins
DUSP3-184HFL	Active Recombinant Full Length Human DUSP3 Protein, N-GST-tagged	+Inquiry
DUSP3-1180R	Recombinant Rhesus Macaque DUSP3 Protein, His (Fc)-Avi-tagged	+Inquiry
DUSP3-28377TH	Recombinant Human DUSP3	+Inquiry
DUSP3-3807H	Recombinant Human DUSP3 protein(Met1-Pro185), His&GST-tagged	+Inquiry
DUSP3-2260H	Recombinant Human DUSP3 Protein, Myc/DDK-tagged, C13 and N15-labeled	+Inquiry
See All DUSP3 Recombinant Proteins