Recombinant Human TG, GST-tagged
Cat.No. : | TG-8266H |
Product Overview : | Human TG partial ORF ( NP_003226, 2671 a.a. - 2768 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | PYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWS KYISSLKTSADGAKGGQSAESEEEE LTAGSGLREDLLSLQEPGSKTYSK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TG thyroglobulin [ Homo sapiens (human) ] |
Official Symbol | TG |
Synonyms | TG; TGN; AITD3; thyroglobulin |
Gene ID | 7038 |
mRNA Refseq | NM_003235 |
Protein Refseq | NP_003226 |
MIM | 188450 |
UniProt ID | P01266 |
Chromosome Location | 8q24 |
Pathway | Autoimmune thyroid disease; Thyroid hormone synthesis |
Function | NOT carboxylesterase activity; hormone activity; NOT neurexin family protein binding |
◆ Recombinant Proteins | ||
TG-708H | Recombinant Human TG Protein, MYC/DDK-tagged | +Inquiry |
TG-8267H | Recombinant Human TG, GST-tagged | +Inquiry |
TG-3207H | Recombinant Human TG, GST-tagged | +Inquiry |
TG-4645H | Thyroglobulin(Human) | +Inquiry |
Tg-6386M | Recombinant Mouse Tg Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
TG-31519TH | Native Human TG | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
TG-37P | Native Porcine TG protein | +Inquiry |
TG-393H | Native Human Thyroglobulin | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TG Products
Required fields are marked with *
My Review for All TG Products
Required fields are marked with *