Recombinant Mouse SIGIRR Protein (1-117 aa), His-tagged

Cat.No. : SIGIRR-2054M
Product Overview : Recombinant Mouse SIGIRR Protein (1-117 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 1-117 aa
Description : Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.7 kDa
AA Sequence : MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Sigirr single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Mus musculus ]
Official Symbol SIGIRR
Synonyms SIGIRR; toll/interleukin-1 receptor 8; TIR8; AI256711; MGC102426;
Gene ID 24058
mRNA Refseq NM_023059
Protein Refseq NP_075546
UniProt ID Q9JLZ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIGIRR Products

Required fields are marked with *

My Review for All SIGIRR Products

Required fields are marked with *

0
cart-icon