Recombinant Mouse p28 Subunit (IL-27) Protein
Cat.No. : | IL27-167M |
Product Overview : | Recombinant Mouse p28 Subunit (IL-27) Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | The p28 subunit of interleukin 27 (IL-27), also known as interleukin 30 (IL-30), is a member of the interleukin 12 (IL-12) family of cytokines. p28 is a secreted polypeptide that associates with the Epstein-Barr virus induced gene 3 (EBI3) to form the IL-27 cytokine heterodimer complex. IL-27 functions as a proinflammatory cytokine that induces immunomodulatory effects in naïve CD4+ T cells, mast cells, and monocytes. p28 can also form a complex with cytokine-like factor 1 (CLF), that is secreted by dendritic cells, to regulate natural killer (NK) and T cell functions. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 23.7 kDa (207 aa) |
AA Sequence : | MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium bicarbonate, pH 8.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Il27 interleukin 27 [ Mus musculus (house mouse) ] |
Official Symbol | IL27 |
Synonyms | IL27; interleukin 27; interleukin-27 subunit alpha; IL27-A; IL-27-A; interleukin 30; IL-27 p28 subunit; IL-27 subunit alpha; p28; Il30; IL-27; IL-27p28; |
Gene ID | 246779 |
mRNA Refseq | NM_145636 |
Protein Refseq | NP_663611 |
UniProt ID | Q8K3I6 |
◆ Recombinant Proteins | ||
IL27-124H | Active Recombinant Human IL27, HIgG1 Fc-tagged, mutant | +Inquiry |
IL27-2306H | Recombinant Human IL27 Protein, His-tagged | +Inquiry |
IL27-167M | Recombinant Mouse p28 Subunit (IL-27) Protein | +Inquiry |
Il27-1032R | Recombinant Rat Il27 Protein, His-tagged | +Inquiry |
IL27-150H | Recombinant Human IL27, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL27-001HCL | Recombinant Human IL27 cell lysate | +Inquiry |
IL27-1309MCL | Recombinant Mouse IL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL27 Products
Required fields are marked with *
My Review for All IL27 Products
Required fields are marked with *