Recombinant Mouse p28 Subunit (IL-27) Protein

Cat.No. : IL27-167M
Product Overview : Recombinant Mouse p28 Subunit (IL-27) Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : The p28 subunit of interleukin 27 (IL-27), also known as interleukin 30 (IL-30), is a member of the interleukin 12 (IL-12) family of cytokines. p28 is a secreted polypeptide that associates with the Epstein-Barr virus induced gene 3 (EBI3) to form the IL-27 cytokine heterodimer complex. IL-27 functions as a proinflammatory cytokine that induces immunomodulatory effects in naïve CD4+ T cells, mast cells, and monocytes. p28 can also form a complex with cytokine-like factor 1 (CLF), that is secreted by dendritic cells, to regulate natural killer (NK) and T cell functions.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 23.7 kDa (207 aa)
AA Sequence : MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium bicarbonate, pH 8.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Il27 interleukin 27 [ Mus musculus (house mouse) ]
Official Symbol IL27
Synonyms IL27; interleukin 27; interleukin-27 subunit alpha; IL27-A; IL-27-A; interleukin 30; IL-27 p28 subunit; IL-27 subunit alpha; p28; Il30; IL-27; IL-27p28;
Gene ID 246779
mRNA Refseq NM_145636
Protein Refseq NP_663611
UniProt ID Q8K3I6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL27 Products

Required fields are marked with *

My Review for All IL27 Products

Required fields are marked with *

0
cart-icon